PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn084161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 274aa    MW: 30778.6 Da    PI: 9.7034
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn084161genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32105158255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Achn084161 105 PRMRWTTTLHARFVRAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 158
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-15102158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28103158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-23105158IPR006447Myb domain, plants
PfamPF002491.2E-7106157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MPTPDASFEL SLSKPTPSVP SSNHFLSPIQ QQQYGLDLGL RFLRPIRGIP VYQNYPPPSF  60
PFSQDHNPSY RSTSTNTPSG LVQTQGVIRS RFLSRFPAKR SMRAPRMRWT TTLHARFVRA  120
VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TMDRGPASPG QPELYETGSS  180
GVTSEDMMFD VENPRKSEVS VQQGRPNVNQ DNDHNYHGLW SNSSREAWLN GNTKNSWGNT  240
STFEDPKCLS YEKILDVTSP KMPNLEFTLG TPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663135.11e-113PREDICTED: probable transcription factor KAN2 isoform X2
SwissprotQ9C6165e-62KAN2_ARATH; Probable transcription factor KAN2
TrEMBLF6HT561e-113F6HT56_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g01940.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-63G2-like family protein